PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00582.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 208aa    MW: 23968.1 Da    PI: 9.8591
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00582.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.93.2e-152673148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT eEd +l +++  +G g W+++a+  g++Rt+k+c++rw++yl
  Rsa1.0_00582.1_g00002.1 26 KGPWTMEEDWILFNYILNHGEGLWNSVAKASGLKRTGKSCRLRWLNYL 73
                             79********************************************97 PP

2Myb_DNA-binding55.21.6e-1779122146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg+ T+eE++l+++++++lG++ W++Ia++++ gRt++++k++w++
  Rsa1.0_00582.1_g00002.1  79 RGNITEEEQLLIIRLHAKLGNR-WSKIAKYLP-GRTDNEIKNFWRT 122
                              7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.92173IPR017930Myb domain
SuperFamilySSF466893.74E-2924120IPR009057Homeodomain-like
SMARTSM007171.9E-102575IPR001005SANT/Myb domain
PfamPF002491.1E-132673IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-212780IPR009057Homeodomain-like
CDDcd001672.57E-72873No hitNo description
PROSITE profilePS5129424.84974128IPR017930Myb domain
SMARTSM007173.8E-1678126IPR001005SANT/Myb domain
PfamPF002492.6E-1679122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-2481127IPR009057Homeodomain-like
CDDcd001672.88E-1283122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0080086Biological Processstamen filament development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MDTKKTEIRK ERIPSQKEEE EGTVRKGPWT MEEDWILFNY ILNHGEGLWN SVAKASGLKR  60
TGKSCRLRWL NYLRPDVRRG NITEEEQLLI IRLHAKLGNR WSKIAKYLPG RTDNEIKNFW  120
RTKIQRHVKL SSSVNTTNIR HCSGNSQSSV ITATDQGSSG KGFDMAESLI SPAKTTTSFH  180
VMEQSNDSYW NVEDQWPLQL LNGDHPVI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-272612827128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00324DAPTransfer from AT3G01530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1180911e-163AK118091.1 Arabidopsis thaliana At3g01530 mRNA for putative transcription factor, complete cds, clone: RAFL19-34-G03.
GenBankBT0055741e-163BT005574.1 Arabidopsis thaliana clone U50886 putative myb family transcription factor (At3g01530) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013585517.11e-140PREDICTED: transcription factor MYB57-like
SwissprotQ9SSA11e-110MYB57_ARATH; Transcription factor MYB57
TrEMBLA0A078IJ111e-140A0A078IJ11_BRANA; BnaC05g48910D protein
STRINGBra039108.1-P1e-127(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01530.11e-111myb domain protein 57